Scaffold Ga0316193_10020796

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0316193_10020796

Scaffold Ga0316193_10020796

Overview

Basic Information
Taxon OID	3300033429 Open in IMG/M
Scaffold ID	Ga0316193_10020796 Open in IMG/M
Source Dataset Name	Coastal sediment microbial communities from Maine, United States - Merrow Island sediment 2
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	5062
Total Scaffold Genes	10 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	7 (70.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Coastal → Sediment → Sediment → Sediment Chemolithoautotrophic Microbial Communities From Various Locations

Source Dataset Sampling Location
Location Name	USA: Maine
Coordinates	Lat. (^o)	43.8826	Long. (^o)	-69.6616	Alt. (m)		Depth (m)	0
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F061862	Metagenome	131	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0316193_100207963	F061862	AGG	MKGKLKMQDDETMWYENDAPVQEYLDRELFRKAAIAEKDPKTVRFSWLEIMKKSFDIK

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.