| Basic Information | |
|---|---|
| Taxon OID | 3300033420 Open in IMG/M |
| Scaffold ID | Ga0316608_1178670 Open in IMG/M |
| Source Dataset Name | Microbial mat bacterial communities from Middle Island sinkhole, Lake Huron, Michigan, United States - MIS.2016.152B |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 538 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Freshwater → Lake → Sediment → Microbial Mat → Microbial Communities From Sediments And Microbial Mats In Various Locations |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | USA: Michigan | |||||||
| Coordinates | Lat. (o) | 45.1993 | Long. (o) | -83.3279 | Alt. (m) | Depth (m) | 185 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F100426 | Metagenome | 102 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0316608_11786701 | F100426 | N/A | MARNRIIYASQSVWCNGEVLYRVQSLGSTTTFSSEDINELGHLDIVDIVDDVPKVAVTLNTNEFGDVKTIATLAQIAPTKAEMNTTAVIGNSNLR |
| ⦗Top⦘ |