NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0310810_10650806

Scaffold Ga0310810_10650806


Overview

Basic Information
Taxon OID3300033412 Open in IMG/M
Scaffold IDGa0310810_10650806 Open in IMG/M
Source Dataset NameSoil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NC
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)996
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil → Soil Microbial Communities From Experimental Microcosm In Duke University, North Carolina, United States

Source Dataset Sampling Location
Location NameUSA: North Carolina
CoordinatesLat. (o)36.0Long. (o)-78.0Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F005292Metagenome / Metatranscriptome405Y

Sequences

Protein IDFamilyRBSSequence
Ga0310810_106508062F005292AGGMSYELVNLSTEVCRTFSRQFWTKALELARVYGWQSKGTRPPSHLNFHELNADWHGTYLTNDGQMVKAEDAFLLAAALEKSLDHISDTNLQIDWNSKFLIEDDLPDWLSPDERAMIEDELQDGLLDIAGINPLQFFAGDEKRHLKEFIRFCRLGSFEIL

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.