Basic Information | |
---|---|
Taxon OID | 3300033412 Open in IMG/M |
Scaffold ID | Ga0310810_10420695 Open in IMG/M |
Source Dataset Name | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NC |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 1369 |
Total Scaffold Genes | 3 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (66.67%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil → Soil Microbial Communities From Experimental Microcosm In Duke University, North Carolina, United States |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | USA: North Carolina | |||||||
Coordinates | Lat. (o) | 36.0 | Long. (o) | -78.0 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F011618 | Metagenome / Metatranscriptome | 289 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0310810_104206952 | F011618 | AGGAGG | MHREHEYKYLADNARKRGGEEQNAQFRAQWEILAATYVQLADQSKKKIDDTGTYYDPLDRARTVWPSSST |
⦗Top⦘ |