| Basic Information | |
|---|---|
| Taxon OID | 3300033405 Open in IMG/M |
| Scaffold ID | Ga0326727_10033912 Open in IMG/M |
| Source Dataset Name | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB29MY |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 8878 |
| Total Scaffold Genes | 10 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 7 (70.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil → Lab Enriched Peat Soil Microbial Communities From Two Peatlands Near Ithaca, Ny, United States |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | USA: New York | |||||||
| Coordinates | Lat. (o) | 42.5488 | Long. (o) | -76.2662 | Alt. (m) | Depth (m) | 0 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F002641 | Metagenome / Metatranscriptome | 540 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0326727_100339129 | F002641 | GAGG | MASTPATPTAAAPRVAGKIIDSVVKVSVDATRPLPMACALYAVENAEGMWLCAYYGANRSVFDYLPQKDAEIEETRLGITFLHKVFIPKDQYQPAQWEQFKKERFMAYGAHAE |
| ⦗Top⦘ |