Scaffold Ga0307417_10019927

Overview

Basic Information

• Taxon OID: 3300033291
• Scaffold ID: Ga0307417_10019927
• Source Dataset Name: Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - WE1602-10
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 2866
• Total Scaffold Genes: 7
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 4 (57.14%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh → Salt Marsh Sediment Microbial Communities From The Plum Island Ecosystem Lter, Massachusetts, United States

Source Dataset Sampling Location

• Location Name: USA: Massachusetts
• Coordinates
  • Lat. (^o): 42.759
  • Long. (^o): -70.891
  • Depth (m): .1

Associated Families

Family	Category	Number of Sequences	3D Structure?
F066180	Metagenome / Metatranscriptome	127	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0307417_100199272	F066180	AGGAG	MASQYPVGDDDDPTLLALEEAFYDVWTVLAAHDPYRDRTEDHDRKVELSRTLMAFVANGVTDVAELRRLGVKSLSLPPNH