| Basic Information | |
|---|---|
| Taxon OID | 3300033180 Open in IMG/M |
| Scaffold ID | Ga0307510_10005651 Open in IMG/M |
| Source Dataset Name | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 14909 |
| Total Scaffold Genes | 16 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 7 (43.75%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Host-Associated → Plants → Roots → Unclassified → Unclassified → Ectomycorrhiza → Soil And Ectomycorrhiza Microbial Communities From Populus Trichocarpa Stands In Riparian Zones In The Pacific Northwest, United States |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | USA: Oregon | |||||||
| Coordinates | Lat. (o) | 45.654 | Long. (o) | -122.839 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F052296 | Metagenome | 142 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0307510_1000565114 | F052296 | GAG | MRVVRMLTMCSVVVLGCVLTCRKVCEEHSRIKMRASSPLKEFRIELIEATLNRCILGIRRVKHIVTAFERREVPRRTIRIALD |
| ⦗Top⦘ |