| Basic Information | |
|---|---|
| Taxon OID | 3300033159 Open in IMG/M |
| Scaffold ID | Ga0326758_109040 Open in IMG/M |
| Source Dataset Name | Hot spring sediment microbial communities from Geyser Creek Basin, Yellowstone National Park, WY, United States - GCR.JH_S |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1102 |
| Total Scaffold Genes | 3 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (33.33%) |
| Novel Protein Genes | 2 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
| Associated Families | 2 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Thermal Springs → Sediment → Unclassified → Hot Spring Sediment → Hot Spring Microbial Communities From Different Geyser Basins In Yellowstone National Park, Wy, United States |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | USA: Wyoming | |||||||
| Coordinates | Lat. (o) | 44.6903 | Long. (o) | -110.7293 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F024139 | Metagenome / Metatranscriptome | 207 | Y |
| F036314 | Metagenome / Metatranscriptome | 170 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0326758_1090402 | F036314 | GGAGG | MSQEGVAQGSQAPQVSEEEKEKAVDGAMIGITLAQLGILEIELMLAGCLSHPDAFTLESWHRWANEALDHDDLDKALHYAEKITKFLEERQKLCEELRKKSRRHNKRYSRHSSRH |
| Ga0326758_1090403 | F024139 | N/A | MAQEVAKKKALKKTLNLKITVYQDPEDNLRFKADIKVNGWTTSFGGWLDRKYIIDYLNMDLYNAWAYLGFVERAKTEESRKNDLDILRLHLEDALAHILAYEIAQDNVVTKEEICNRWWKQVGEKECAYTECAGFAKEDFDACMESCKKELCGS |
| ⦗Top⦘ |