| Basic Information | |
|---|---|
| Taxon OID | 3300033002 Open in IMG/M |
| Scaffold ID | Ga0346503_1122495 Open in IMG/M |
| Source Dataset Name | Soil microbial community from agricultural field in Dibrughar, Assam, India - D1 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Eurofins Genomics India Pvt Ltd. |
| Sequencing Status | Finished |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 693 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Terrestrial → Soil → Unclassified → Contaminated → Soil → Crude Oil Contaminated Agricultural Soil Mecrobial Communities From Various Regions In India |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Dibrughar, Assam, India | |||||||
| Coordinates | Lat. (o) | 26.2006043 | Long. (o) | 92.9375739 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F090719 | Metagenome / Metatranscriptome | 108 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0346503_11224951 | F090719 | AGGAGG | MNEIAGRTPIDRGQGTLVAPDPIHPKIRAMEVIDTDFHFTPAWKDLHQYLTEPFRSLMWHFPLGGMEYNPEPPNEKPGEGQDTHGTASSGEDVLRILDQFGEDIVILNPGFNRAQSIFNEPMISAVASAYNDFLIERV |
| ⦗Top⦘ |