NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0335074_11250053

Scaffold Ga0335074_11250053


Overview

Basic Information
Taxon OID3300032895 Open in IMG/M
Scaffold IDGa0335074_11250053 Open in IMG/M
Source Dataset NameSoil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.3
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)620
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil → Soil Microbial Communities From Loxahatchee National Wildlife Refuge, Florida, United States

Source Dataset Sampling Location
Location NameUSA: Florida
CoordinatesLat. (o)26.5059Long. (o)-80.2517Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F001323Metagenome / Metatranscriptome722Y
F024158Metagenome / Metatranscriptome207Y
F025552Metagenome / Metatranscriptome201Y

Sequences

Protein IDFamilyRBSSequence
Ga0335074_112500531F024158GGAGGMRNHDVTALTGRELEQARRELAASLALARPGSPARVPILARMSAINAELAQRVTAGTPGDLP
Ga0335074_112500532F001323AGGAGGVTSSGQAAAPGPAAPGTVAAPGHAMHALTTYELRDYRRQLETAIAFFDRQDPVPPARHRLQASLDEVLAEQEDRRRLADAQP
Ga0335074_112500533F025552N/AEMDSYAMLYQDWGSAYRITRTPGTAHPYQAERRDDPAVVLTAASPGALRDLIRADYLARPSPRR
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.