NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0335074_10071507

Scaffold Ga0335074_10071507


Overview

Basic Information
Taxon OID3300032895 Open in IMG/M
Scaffold IDGa0335074_10071507 Open in IMG/M
Source Dataset NameSoil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.3
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)4683
Total Scaffold Genes7 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)5 (71.43%)
Novel Protein Genes4 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (50.00%)
Associated Families4

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Alcaligenaceae → Pusillimonas (ex Stolz et al. 2005) → unclassified Pusillimonas → Pusillimonas sp. (ex Stolz et al. 2005)(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil → Soil Microbial Communities From Loxahatchee National Wildlife Refuge, Florida, United States

Source Dataset Sampling Location
Location NameUSA: Florida
CoordinatesLat. (o)26.5059Long. (o)-80.2517Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F001698Metagenome / Metatranscriptome650Y
F013663Metagenome / Metatranscriptome269Y
F037832Metagenome / Metatranscriptome167Y
F057529Metagenome / Metatranscriptome136Y

Sequences

Protein IDFamilyRBSSequence
Ga0335074_100715073F013663N/AVDGRPDRDGEEQLGLLGAAWEKTAQHWQDGVARQFETDHWAPLAERSRAYLGALRTLLDMLETAERDTEF
Ga0335074_100715075F001698AGGAGMSGVINDIDALTEFRAHLIQFNRDLAENFATMRGHWRELGEVWRDDMYRLFGEALDEVTPGITTYLAATEGHEAHLAALAERLREYLETGVGAGAAAGTNRNESRR
Ga0335074_100715076F037832GAGMTTQERIGEPAMVSPYVSLRQAVRPAIFAQFLLAEDRERAGRLAAECEDLLFLTRELLKAAGQAGILGDAPAESESPPPLDEDGGDRQEQLLGAYAQAGLLWAKVVGSTMALARSLLDRRDWDGARRLAGFLAEAGEDGAAAELRIQLGKAVWDTYREQLQAIGNRMPPAGIQTAIAALRALLLEVPEDYPDRNRQVNRFLPPLAASVHAVMREQKVDIPYSSRVEHIATGGVARYPDIVTLSLDEIAAEFEGICNRPGNE
Ga0335074_100715077F057529N/APAESDSLLGVSAAASLDDDRALYRDTEWPAEQVEKFKPYSVTSLYSFIRAAFESPA
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.