Basic Information | |
---|---|
Taxon OID | 3300032892 Open in IMG/M |
Scaffold ID | Ga0335081_12081392 Open in IMG/M |
Source Dataset Name | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 602 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil → Soil Microbial Communities From Loxahatchee National Wildlife Refuge, Florida, United States |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | USA: Florida | |||||||
Coordinates | Lat. (o) | 26.5065 | Long. (o) | -80.2537 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F029380 | Metagenome | 188 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0335081_120813922 | F029380 | N/A | TPFSLDLSSLSPVRGAEPPTNGEVRPVAVPGSSLDLTLTLPLASAEGPYDLKLTAGGHTIWSRTAQAHLSNGKTLIQLQADFSQIPTGLYNLEVQSSSGIHLIQAVAIQCSPPKSGEQRP |
⦗Top⦘ |