Scaffold Ga0335070_10130198

Overview

Basic Information

• Taxon OID: 3300032829
• Scaffold ID: Ga0335070_10130198
• Source Dataset Name: Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 2588
• Total Scaffold Genes: 5
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (20.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil → Soil Microbial Communities From Loxahatchee National Wildlife Refuge, Florida, United States

Source Dataset Sampling Location

• Location Name: USA: Florida
• Coordinates
  • Lat. (^o): 26.5008
  • Long. (^o): -80.2398

Associated Families

Family	Category	Number of Sequences	3D Structure?
F037355	Metagenome / Metatranscriptome	168	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0335070_101301985	F037355	N/A	VTAGTWILCAVYAVVTAILAWLLMISRGWMEKAYFGLCTISAFSGLFRTIAGDHTFHAGLYVRVAMLGSAVLVGLAIVRTHSELVAESS