NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0335070_10002352

Scaffold Ga0335070_10002352


Overview

Basic Information
Taxon OID3300032829 Open in IMG/M
Scaffold IDGa0335070_10002352 Open in IMG/M
Source Dataset NameSoil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)22047
Total Scaffold Genes24 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)23 (95.83%)
Novel Protein Genes4 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)4 (100.00%)
Associated Families4

Taxonomy
All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil → Soil Microbial Communities From Loxahatchee National Wildlife Refuge, Florida, United States

Source Dataset Sampling Location
Location NameUSA: Florida
CoordinatesLat. (o)26.5008Long. (o)-80.2398Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F001558Metagenome / Metatranscriptome671Y
F003233Metagenome / Metatranscriptome499Y
F006672Metagenome / Metatranscriptome367Y
F018460Metagenome / Metatranscriptome235Y

Sequences

Protein IDFamilyRBSSequence
Ga0335070_1000235218F003233AGGAGGMNIRQILVLVAIIACVWHTAAAQPKKRKVEVNAPPPESILADTSIQSNPVLSDLNALKPEMPLSPQDVLKSYEIAMGLVADKTAADFSIIVQAQQTNQITREQAEYLLQQRYQIAMMQYQVLSALHDVLKHDIEEATLQSKRSFKAANSNEVLVVPLPVSPPDSR
Ga0335070_1000235221F018460AGGAGMQRLIAVIALCFVTFPALCQSTSKYQVATITDVKPHQSAGDPAFDATSYDVSVKVGDTIYVVLYETPLGEVPPKYVAGRQMLVLVGKDTITYNDILGRSLQVPIKGQRPATESKSSK
Ga0335070_1000235222F006672AGGAGMKSFETLPGESNSSIISSIINLVCPQCGGRMCEFQCEGRCGRSWLAEWEWANLKTSSSQVPAYRRDRVGPRTRASH
Ga0335070_100023528F001558GAGGMSKEFIMLRVEKEKLDGALICRLEGRFTGEGAEQVRTLVTRCDSKLELVVDLTEVMFIDAVGEDVLSFVRKLGGQFVAETAYSRDVCERLQLPMVRNHEQNSQLSGNRGGNGHRPANNSHRQ
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.