NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0335080_10099283

Scaffold Ga0335080_10099283


Overview

Basic Information
Taxon OID3300032828 Open in IMG/M
Scaffold IDGa0335080_10099283 Open in IMG/M
Source Dataset NameSoil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)3230
Total Scaffold Genes6 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (33.33%)
Novel Protein Genes4 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (50.00%)
Associated Families4

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Nocardiopsaceae → Nocardiopsis → Nocardiopsis algeriensis(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil → Soil Microbial Communities From Loxahatchee National Wildlife Refuge, Florida, United States

Source Dataset Sampling Location
Location NameUSA: Florida
CoordinatesLat. (o)26.5065Long. (o)-80.2537Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F001698Metagenome / Metatranscriptome650Y
F002850Metagenome / Metatranscriptome526Y
F004352Metagenome / Metatranscriptome442Y
F006575Metagenome / Metatranscriptome370Y

Sequences

Protein IDFamilyRBSSequence
Ga0335080_100992832F006575GGAGMTIEPGTAASPYLSLRQAVRPAILAHRLLAGDQERAGKLATECEDLLYLTGELLKAAGRARILATAPPPRMPDEGSGDRQAQFLEAYADAGLLWAKVVGSSLALAGALIERGEWEDVRALASFLAGAGEESAATELRIQLGRAAWEAHRDQLRAVSNDMPPAAIEPAINALRAVLREVPEEYPDRNREVNRFLPPLASAIHAIMKQQEADIPYHSRVEHIATGGVAKYPDIVKTSLDELAAEFEGICRRPGGKTP
Ga0335080_100992833F001698AGGAGMAGVINDIEALAAFRAHLMRFNHDLAENFATMQAHWRELGEVWRDDMYRLFGEALEEVTPGIATYLSATEGHEAHLAALIERLTGYLETGAGAGLGVGRPPEAGRGPGNGTGRH
Ga0335080_100992834F002850N/ALTGIHADIDALRGLHGALVKYRHAQRDMAARGEDQLRAARASLEAKASRCRAQLELSQAELGACQDRAARVAAGDTDGDTVDCSGYARAVELCAERLESIRRWQQRIDAEASEFQGIAGQFTDLLENELPRMEEHLAAIIASLESARRVQAPAS
Ga0335080_100992835F004352N/AMISRPDQDGDQQVRLLDDAWGKAAEHWQDGTARQFGAAQLTPLLQESRSYLEALRRLMDVLEAAERDTEG
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.