| Basic Information | |
|---|---|
| Taxon OID | 3300032820 Open in IMG/M |
| Scaffold ID | Ga0310342_102515913 Open in IMG/M |
| Source Dataset Name | Marine microbial communities from station ALOHA, North Pacific Subtropical Gyre - S1503-DNA-20-500_MG |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 616 |
| Total Scaffold Genes | 3 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (66.67%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Oceanic → Unclassified → Seawater → Comprehensive Metagenome And Single Cell Genome Sequencing From The Open Ocean Community Of North Pacfic Subtropical Gyre, Station Aloha |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Pacific Ocean: North Pacific Subtropical Gyre | |||||||
| Coordinates | Lat. (o) | 22.8644 | Long. (o) | -158.9436 | Alt. (m) | Depth (m) | 500 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F018016 | Metagenome / Metatranscriptome | 237 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0310342_1025159132 | F018016 | AGGAG | MQKQVPDRQSDKITIDTPYGTIESDSGNHFVDVATILVIISFCVFLKLKGALLLKRMFKK |
| ⦗Top⦘ |