Scaffold Ga0310342_102068720

Overview

Basic Information

• Taxon OID: 3300032820
• Scaffold ID: Ga0310342_102068720
• Source Dataset Name: Marine microbial communities from station ALOHA, North Pacific Subtropical Gyre - S1503-DNA-20-500_MG
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 681
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: Not Available (Source: )

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Oceanic → Unclassified → Seawater → Comprehensive Metagenome And Single Cell Genome Sequencing From The Open Ocean Community Of North Pacfic Subtropical Gyre, Station Aloha

Source Dataset Sampling Location

• Location Name: Pacific Ocean: North Pacific Subtropical Gyre
• Coordinates
  • Lat. (^o): 22.8644
  • Long. (^o): -158.9436
  • Depth (m): 500

Associated Families

Family	Category	Number of Sequences	3D Structure?
F025302	Metagenome / Metatranscriptome	202	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0310342_1020687202	F025302	GAGG	VNWLSAITAVSKLLGALTGLYRDWRLRRAGAKEAYLSALEAEQVRAKRLAEMTAHLDTLDDLDLRLRQYQRASGRLRMGKTNHRGRGRRADDRNHAGAAGAQ