Scaffold Ga0310342_100022116

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0310342_100022116

Scaffold Ga0310342_100022116

Overview

Basic Information
Taxon OID	3300032820 Open in IMG/M
Scaffold ID	Ga0310342_100022116 Open in IMG/M
Source Dataset Name	Marine microbial communities from station ALOHA, North Pacific Subtropical Gyre - S1503-DNA-20-500_MG
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	4905
Total Scaffold Genes	10 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	6 (60.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Seawater → Comprehensive Metagenome And Single Cell Genome Sequencing From The Open Ocean Community Of North Pacfic Subtropical Gyre, Station Aloha

Source Dataset Sampling Location
Location Name	Pacific Ocean: North Pacific Subtropical Gyre
Coordinates	Lat. (^o)	22.8644	Long. (^o)	-158.9436	Alt. (m)		Depth (m)	500
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F041139	Metagenome	160	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0310342_1000221166	F041139	N/A	MNPVWIRKPGMSWEEMYNDALYTIGLLKKEIDTLRAIVRVQLPIVGEDDENIQSIE

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.