Basic Information | |
---|---|
Taxon OID | 3300032812 Open in IMG/M |
Scaffold ID | Ga0314745_1035266 Open in IMG/M |
Source Dataset Name | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_17JUL2017_LR1 (Metagenome Metatranscriptome) |
Source Dataset Category | Metatranscriptome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 1065 |
Total Scaffold Genes | 1 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → Viruses → Riboviria → Orthornavirae → Lenarviricota → Miaviricetes → Ourlivirales → Botourmiaviridae → Ourmiavirus | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Switchgrass Phyllosphere → Phyllosphere Microbial Comminities From Bioenergy Crops Switchgrass And Miscanthus From Michigan, Usa |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | USA: Michigan | |||||||
Coordinates | Lat. (o) | 42.3956 | Long. (o) | -85.372 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F104115 | Metatranscriptome | 100 | N |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0314745_10352661 | F104115 | N/A | GEVTHGQMMGAYLSFPLLCLQSYLAARWAMRGHQASYLVNGDDCLVSSDAYVSPESYPSGWKLNDKKTIRSEVVAEVNSTAFLSGGGKWREVRHLRRGGFQTDFKGMMHAASAVRFSREWTDAFVRSRIGKKWGFLPHQLRLHPKSYPAFCRTREMWHRLFTPLPLAPSQERSPEIIGLRRALDPDERIAFTAWQWQNGRDGGRKRDVYSPSVGELRRTYAYRVVKPWSRLSYVSKLASLKYDDAYGNVEGDMQFVPDEYISLREMRAIREKLCFIPQVDG |
⦗Top⦘ |