Basic Information | |
---|---|
Taxon OID | 3300032805 Open in IMG/M |
Scaffold ID | Ga0335078_10023831 Open in IMG/M |
Source Dataset Name | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 9091 |
Total Scaffold Genes | 7 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 4 (57.14%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → Acidobacteria | (Source: IMG/M) |
Source Dataset Ecosystem |
---|
Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil → Soil Microbial Communities From Loxahatchee National Wildlife Refuge, Florida, United States |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | USA: Florida | |||||||
Coordinates | Lat. (o) | 26.5065 | Long. (o) | -80.2537 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F030508 | Metagenome / Metatranscriptome | 185 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0335078_100238313 | F030508 | GAG | MARKGRASDSDREVIMSAKISMVVLLALVSAMPLSAHDKKKDLERGMLEKMDAVPCGAKQRGLAGLGSLWASVGITHVNSDEKLCPQYLLRSDQMDYVIRPLDLKHAKILPVGTEGEFRIDKKVMILTMPEGDDRKMHEYQVVAMTPNNPGNDDGKSSSLTPGEH |
⦗Top⦘ |