NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0314748_1063456

Scaffold Ga0314748_1063456


Overview

Basic Information
Taxon OID3300032791 Open in IMG/M
Scaffold IDGa0314748_1063456 Open in IMG/M
Source Dataset NameMetatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_07AUG2017_LR1 (Metagenome Metatranscriptome)
Source Dataset CategoryMetatranscriptome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)787
Total Scaffold Genes1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → Viruses → Riboviria → Orthornavirae → Lenarviricota → Miaviricetes → Ourlivirales → Botourmiaviridae → Ourmiavirus(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Switchgrass Phyllosphere → Phyllosphere Microbial Comminities From Bioenergy Crops Switchgrass And Miscanthus From Michigan, Usa

Source Dataset Sampling Location
Location NameUSA: Michigan
CoordinatesLat. (o)42.3951Long. (o)-85.3736Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F104115Metatranscriptome100N

Sequences

Protein IDFamilyRBSSequence
Ga0314748_10634561F104115N/AGIRELAHLSLRPLVTVNGVIEGEVTHGQMMGAYLSFPLLCLQSYLAARWAMRGHKATYLVNGDDCLVSSDAYVSAESYPSGWRLNDKKTIRSEVVAEVNSTAFLSGGGKWREVRHLRRGGFQTDFKGMLHIASAVRGSREWTDAFVHSRIGKKWGFLPSQLSLHPKSYPAFSRGREMWHRCHTPLPLAPSQDRGEGVLGLRRALDPDERMAFTAWQWSHGRDGGRKRDVYSPSVGEVRRTYAYKVVKPWSRLSFVSKLKSL

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.