Scaffold Ga0335079_10203180

Overview

Basic Information

• Taxon OID: 3300032783
• Scaffold ID: Ga0335079_10203180
• Source Dataset Name: Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 2198
• Total Scaffold Genes: 4
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (25.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117 (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil → Soil Microbial Communities From Loxahatchee National Wildlife Refuge, Florida, United States

Source Dataset Sampling Location

• Location Name: USA: Florida
• Coordinates
  • Lat. (^o): 26.5065
  • Long. (^o): -80.2537

Associated Families

Family	Category	Number of Sequences	3D Structure?
F025870	Metagenome / Metatranscriptome	200	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0335079_102031802	F025870	N/A	MTPIQIHLCERLKQLGFSRNNQIKLYGSQFELVGDPLVISEDVVFVDALERKSGQSCRVRIPLNIVRMATEQASQAYAA