Scaffold Ga0335085_10023966

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0335085_10023966

Scaffold Ga0335085_10023966

Overview

Basic Information
Taxon OID	3300032770 Open in IMG/M
Scaffold ID	Ga0335085_10023966 Open in IMG/M
Source Dataset Name	Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	8621
Total Scaffold Genes	14 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	10 (71.43%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil → Soil Microbial Communities From Loxahatchee National Wildlife Refuge, Florida, United States

Source Dataset Sampling Location
Location Name	USA: Florida
Coordinates	Lat. (^o)	26.5052	Long. (^o)	-80.2345	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F003312	Metagenome / Metatranscriptome	494	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0335085_100239664	F003312	GGAGG	MHPLFVTLFIMTDTDDLLTEEQDRKRRAYAARRGRSARVMRVAAADPDRPLRP

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.