Scaffold Ga0335085_10000617

Overview

Basic Information

• Taxon OID: 3300032770
• Scaffold ID: Ga0335085_10000617
• Source Dataset Name: Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 95349
• Total Scaffold Genes: 103
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 77 (74.76%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil → Soil Microbial Communities From Loxahatchee National Wildlife Refuge, Florida, United States

Source Dataset Sampling Location

• Location Name: USA: Florida
• Coordinates
  • Lat. (^o): 26.5052
  • Long. (^o): -80.2345

Associated Families

Family	Category	Number of Sequences	3D Structure?
F057548	Metagenome / Metatranscriptome	136	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0335085_1000061798	F057548	GGAGG	MVAAMQYRIEISANREGVARIHLPGRSLELEAHRDDSGWQVAVVDPQNPPPNEGDNTIALRADSANDAVWRVARAAVRAVSELTNSPLPAELRHDPDI