Scaffold Ga0315742_13200625

Overview

Basic Information

• Taxon OID: 3300032756
• Scaffold ID: Ga0315742_13200625
• Source Dataset Name: Forest Soil Metatranscriptomics Site 2 Humus Litter Mineral Combined Assembly
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 528
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil → Forest Soil Microbial Communities From France, Sweden, Spain And Usa, For Metatranscriptomics Studies

Source Dataset Sampling Location

• Location Name: Sweden: Dalarna County
• Coordinates
  • Lat. (^o): 60.97
  • Long. (^o): 15.87

Associated Families

Family	Category	Number of Sequences	3D Structure?
F014759	Metagenome / Metatranscriptome	260	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0315742_132006251	F014759	N/A	TALVYLSHWPLQALDLPTASAFAGLLVAAGGAAVKFYKSRTASVVTRAASVVPITPAGAVHEMQVVGQGLAAV