Basic Information | |
---|---|
Taxon OID | 3300032753 Open in IMG/M |
Scaffold ID | Ga0316224_1023959 Open in IMG/M |
Source Dataset Name | Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - TBH18013 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 2938 |
Total Scaffold Genes | 5 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 3 (60.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella | (Source: IMG/M) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater → Microbial Communities From Trout Bog Lake Hypolimnion, Wisconsin, Usa |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | USA: Wisconsin | |||||||
Coordinates | Lat. (o) | 46.0411 | Long. (o) | -89.6861 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F062357 | Metagenome | 130 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0316224_10239591 | F062357 | N/A | GNSIVTDSLRGNPEQLHASHAGKDSEILHNGKALDSIAFRMRVMNLTAGESYKGRMGEFNKTLRARRMDRTRSRGVAEW |
⦗Top⦘ |