NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0314701_10093343

Scaffold Ga0314701_10093343


Overview

Basic Information
Taxon OID3300032746 Open in IMG/M
Scaffold IDGa0314701_10093343 Open in IMG/M
Source Dataset NameMetatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Plim7_28May_deep (Eukaryote Community Metatranscriptome)
Source Dataset CategoryMetatranscriptome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1235
Total Scaffold Genes1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Suessiaceae → Polarella → Polarella glacialis(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Seawater → Seawater Microbial Communities From Espelandsvegen Fjord, Bergen, Norway

Source Dataset Sampling Location
Location NameNorway: Bergen
CoordinatesLat. (o)60.2696Long. (o)5.2187Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F005747Metatranscriptome391Y

Sequences

Protein IDFamilyRBSSequence
Ga0314701_100933431F005747N/AEVVALPEDVPEAERGSPQFAEQFIVHQLGSDRLIRTQNAAKFAIYSQIRSTLWYDFLAEKNGTAKLRHDTFYDDLGYKWLDNGLVTEIHTQTKEERAANITGPMVSMLHGLLGWGQYMGGLTCLADPVGVPVLGGKVSTRGIEYSAFLEGADYLGRIKIGVEYDGFKLGDKGHGDMKAKRNMTVDHYIKWFLHVYVDADPTSPTYRQPIRFYGPYSGFAVYVKFDKTVPPAEVWDHVCPDNGWGEEESKPIHPCKGKKISDYKAMIVEKAHPEVCDFLKNKTIQDVEGLGGDHIRGNFGSFFAPEMSNQEIVV

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.