| Basic Information | |
|---|---|
| Taxon OID | 3300032740 Open in IMG/M |
| Scaffold ID | Ga0325411_1043371 Open in IMG/M |
| Source Dataset Name | Populus deltoides microbial communities from Bellville, Georgia, United States - Xylem-PdIQD-R4 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 2901 |
| Total Scaffold Genes | 4 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (50.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Host-Associated → Plants → Wood → Unclassified → Unclassified → Xylem → Understanding The Reciprocal Impacts Of Modified Plant Cell Wall And Associated Microbiome |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | USA: Georgia | |||||||
| Coordinates | Lat. (o) | 32.1348 | Long. (o) | -81.9657 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F032515 | Metagenome | 179 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0325411_10433711 | F032515 | N/A | VGCDPSWDFFHERKTIQAQKGIARDVLISERERNNKDGLSSFQTQATMINKL |
| ⦗Top⦘ |