Scaffold Ga0315741_10657968

Overview

Basic Information

• Taxon OID: 3300032739
• Scaffold ID: Ga0315741_10657968
• Source Dataset Name: Forest Soil Metatranscriptomics Site 2 LB Combined Assembly
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 892
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Gnathifera → Rotifera → Eurotatoria → Bdelloidea → Rotaria → Rotaria sordida (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil → Forest Soil Microbial Communities From France, Sweden, Spain And Usa, For Metatranscriptomics Studies

Source Dataset Sampling Location

• Location Name: Sweden: Dalarna County
• Coordinates
  • Lat. (^o): 60.97
  • Long. (^o): 15.87

Associated Families

Family	Category	Number of Sequences	3D Structure?
F080739	Metagenome / Metatranscriptome	114	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0315741_106579681	F080739	N/A	CYCATTSVDEQSSENKKNVSMMIDNKDDDVKLSDKRDGKYFNYLRLLDGQCHNCSTYKCTNHKANMGGSEWCIMLFSDALAHCDSDPNCGGYTMTTGEWFHKKYDKNGQVAVHLTKAGEKSIACPLSEWSSYDKQKDVRGTPVVYGRSTCENSINRNKDTCDKVHNFKYVFESNSNVVIDGIPYLCKDHPNNLDNKDLNCILSITDGVTLCNSDSQCQGFLINTDDNWQKKFSNNGMQAVQLFGQGVTYTDSQTWRIFKKQH