Basic Information | |
---|---|
Taxon OID | 3300032727 Open in IMG/M |
Scaffold ID | Ga0314693_10650832 Open in IMG/M |
Source Dataset Name | Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Plim5_22May_deep (Eukaryote Community Metatranscriptome) |
Source Dataset Category | Metatranscriptome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 569 |
Total Scaffold Genes | 1 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Malacostraca → Eumalacostraca → Peracarida → Amphipoda → Senticaudata → Talitrida → Talitroidea → Hyalellidae → Hyalella → Hyalella azteca | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Oceanic → Unclassified → Seawater → Seawater Microbial Communities From Espelandsvegen Fjord, Bergen, Norway |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Norway: Bergen | |||||||
Coordinates | Lat. (o) | 60.2696 | Long. (o) | 5.2187 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F035613 | Metatranscriptome | 171 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0314693_106508321 | F035613 | N/A | REQHTHSTMFSLAVASVVLGVAMATPVLPRDDINVAHARNAFLQEYNRLAALAAAAPDIHIIMGTRQLPHQVPVTHVNNVPAGHLAGHLAGHLAGHQVPVINPTPTFVPSGPIMTWAGPFADTVPAGVNGLPQQVRETPEVAAARAALVRAHANAPRPNPLFNPPQQVL |
⦗Top⦘ |