Scaffold Ga0314703_10187679

Overview

Basic Information

• Taxon OID: 3300032723
• Scaffold ID: Ga0314703_10187679
• Source Dataset Name: Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Shad8_26May_surf (Eukaryote Community Metatranscriptome)
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 856
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Prymnesiales → Chrysochromulinaceae → Chrysochromulina → Chrysochromulina tobinii (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Oceanic → Unclassified → Seawater → Seawater Microbial Communities From Espelandsvegen Fjord, Bergen, Norway

Source Dataset Sampling Location

• Location Name: Norway: Bergen
• Coordinates
  • Lat. (^o): 60.2696
  • Long. (^o): 5.2187

Associated Families

Family	Category	Number of Sequences	3D Structure?
F007565	Metagenome / Metatranscriptome	348	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0314703_101876791	F007565	N/A	SVAMGTAAGFFGITYQGAVNGLASVTLSIFNMDHPDDRAWLKHVFDFVTEGVDALPQEKVGDLLQCFYRNRSEGPTQSGSYLYQFPENEYTFLCALYEDGARAINFATLMDALMAAQADFAEPAAPLEYGSNLVLRNDRVKHTRNVLHPQQQFRKPMTTSQEVGWELLTAIGPDEKPEGHPFHLRTSATTQFADAMEKQTWGRSIGGEFSAFAARKLAEFGGLGMGV