| Basic Information | |
|---|---|
| Taxon OID | 3300032711 Open in IMG/M |
| Scaffold ID | Ga0314681_10235880 Open in IMG/M |
| Source Dataset Name | Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red3_24May_deep (Eukaryote Community Metatranscriptome) |
| Source Dataset Category | Metatranscriptome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 989 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Eukaryota | (Source: IMG/M) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Oceanic → Unclassified → Seawater → Seawater Microbial Communities From Espelandsvegen Fjord, Bergen, Norway |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Norway: Bergen | |||||||
| Coordinates | Lat. (o) | 60.2696 | Long. (o) | 5.2187 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F002472 | Metatranscriptome | 556 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0314681_102358801 | F002472 | GAGG | VKQAPAWNDVCKQFHGNPDVAFGDVSLSSNQVRTIHGEAQNPGAGGWPTVRHFNKETGYGGKAYVQKTQTAMCDELGPKTEYMGMHIEEAAGTSLCNVTTKQGCSDEQTKFIAKWGDKAKDELQKQVDRLTGMVDKDGASMKAEALTWAKQRLNIVKKLHAKEEL |
| ⦗Top⦘ |