Scaffold Ga0316230_1197463

Overview

Basic Information

• Taxon OID: 3300032668
• Scaffold ID: Ga0316230_1197463
• Source Dataset Name: Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - TBH18025
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 715
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 3 → unclassified Verrucomicrobia subdivision 3 → Verrucomicrobia subdivision 3 bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater → Microbial Communities From Trout Bog Lake Hypolimnion, Wisconsin, Usa

Source Dataset Sampling Location

• Location Name: USA: Wisconsin
• Coordinates
  • Lat. (^o): 46.0411
  • Long. (^o): -89.6861

Associated Families

Family	Category	Number of Sequences	3D Structure?
F003261	Metagenome / Metatranscriptome	497	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0316230_11974631	F003261	N/A	ASVNQKRFFFVRRLIENSSRFKLPPVQQPQQLETLDDLMAQAGHYAEFCMRNSGKMTPTLFLIGADGPLMFVPTSLADESEKDAFATTARLMCIANAATVCVMAMEAWMKTAKPGEKLDMTEPPSESFDRQEVVVLMGEDRTGQQQKFLPIIRSGNGKFFGFNESDMPQLDSMEGRFAGILPPNVATDEHRTLAKVMLKVKGVNITKPGTTVRLTPPRR