Scaffold Ga0316230_1016461

Overview

Basic Information

• Taxon OID: 3300032668
• Scaffold ID: Ga0316230_1016461
• Source Dataset Name: Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - TBH18025
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 4011
• Total Scaffold Genes: 15
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 8 (53.33%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → Predicted Viral (Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater → Microbial Communities From Trout Bog Lake Hypolimnion, Wisconsin, Usa

Source Dataset Sampling Location

• Location Name: USA: Wisconsin
• Coordinates
  • Lat. (^o): 46.0411
  • Long. (^o): -89.6861

Associated Families

Family	Category	Number of Sequences	3D Structure?
F028070	Metagenome / Metatranscriptome	192	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0316230_101646115	F028070	AGAAG	MEKIKYTVQMAKDIRKLKCPVKGLIMDIRARPNYLAVTVYEDNVMEYNESQRMQLMEYLLLVRQLVMAYGTPCEIEGWAGN