| Basic Information | |
|---|---|
| Taxon OID | 3300032616 Open in IMG/M |
| Scaffold ID | Ga0314671_10582732 Open in IMG/M |
| Source Dataset Name | Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red2_26May_surf (Eukaryote Community Metatranscriptome) |
| Source Dataset Category | Metatranscriptome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 605 |
| Total Scaffold Genes | 1 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Oceanic → Unclassified → Seawater → Seawater Microbial Communities From Espelandsvegen Fjord, Bergen, Norway |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Norway: Bergen | |||||||
| Coordinates | Lat. (o) | 60.2696 | Long. (o) | 5.2187 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F011061 | Metagenome / Metatranscriptome | 295 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0314671_105827321 | F011061 | N/A | MDQLRREESSTFAESKATLEKGITGIRFALNILTEYYAQDGQAHEAADGAASGIVGLLETVEADFTKNLAQISADEDAAGASHDSTTRENQIDRTSKDQSLKYKSKESKDLDKYAGELTSDRSNVQAELDAVNEYLSKMEEQCIAKAEAYSVRQDRYAAEIAGLKQALDILES |
| ⦗Top⦘ |