NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0316232_1306089

Scaffold Ga0316232_1306089


Overview

Basic Information
Taxon OID3300032605 Open in IMG/M
Scaffold IDGa0316232_1306089 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Trout Bog Lake, Wisconsin, USA - TBH18025_13
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)593
Total Scaffold Genes1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater → Microbial Communities From Trout Bog Lake Hypolimnion, Wisconsin, Usa

Source Dataset Sampling Location
Location NameUSA: Wisconsin
CoordinatesLat. (o)46.0411Long. (o)-89.6861Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F028681Metagenome / Metatranscriptome190Y

Sequences

Protein IDFamilyRBSSequence
Ga0316232_13060891F028681AGGAGMSTSAGIGGAFGLLLPEFPKVGAIYGDLKFVVNRALEGKGSGDPGDMESAPEVLRVRDRLIESFAGIGIIVPASAALLWTGSEADRLARCETPSDEWILGFGVFTN

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.