Scaffold Ga0316232_1070828

Overview

Basic Information

• Taxon OID: 3300032605
• Scaffold ID: Ga0316232_1070828
• Source Dataset Name: Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - TBH18025_13
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1653
• Total Scaffold Genes: 6
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 5 (83.33%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater → Microbial Communities From Trout Bog Lake Hypolimnion, Wisconsin, Usa

Source Dataset Sampling Location

• Location Name: USA: Wisconsin
• Coordinates
  • Lat. (^o): 46.0411
  • Long. (^o): -89.6861

Associated Families

Family	Category	Number of Sequences	3D Structure?
F017628	Metagenome / Metatranscriptome	239	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0316232_10708281	F017628	AGGA	MATYDVDALKADLPTAKDLAQFVYDKTQIALDLIGKPKEEQYLVAKNALEGKKIPSEYQTDENPYVDRKELIPVDEMKEIPPRSPDLPPETSRVHFFGATNMPHPLDPQSDRKVMINFWKYDNGMI