NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0316226_1008436

Scaffold Ga0316226_1008436


Overview

Basic Information
Taxon OID3300032562 Open in IMG/M
Scaffold IDGa0316226_1008436 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Trout Bog Lake, Wisconsin, USA - TBH18017
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)7095
Total Scaffold Genes16 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)11 (68.75%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater → Microbial Communities From Trout Bog Lake Hypolimnion, Wisconsin, Usa

Source Dataset Sampling Location
Location NameUSA: Wisconsin
CoordinatesLat. (o)46.0411Long. (o)-89.6861Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F048060Metagenome / Metatranscriptome148Y
F054519Metagenome / Metatranscriptome139Y

Sequences

Protein IDFamilyRBSSequence
Ga0316226_10084364F054519GGAMDADLIALRDEIDARLVEVEQSRGTCSGHPALARALGTLLRCQRAQLNQRAATMNSAAKVGGAVGALLIGAIEAAKYLFGK
Ga0316226_10084366F048060AGGMWQALFTAILDWLTGLVKSQTQTVGEDVVAKPGLKESLDKRLSEWKARKGVT

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.