Scaffold Ga0348332_10676619

Overview

Basic Information

• Taxon OID: 3300032515
• Scaffold ID: Ga0348332_10676619
• Source Dataset Name: FICUS49499 Metatranscriptome Czech Republic combined assembly (additional data)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 785
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0017 (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter → Soil, Plant Litter And Rhizosphere Microbial Communities From European Coniferous Forests

Source Dataset Sampling Location

• Location Name: Czech Republic: South Bohemian Region
• Coordinates
  • Lat. (^o): 49.0431
  • Long. (^o): 13.617

Associated Families

Family	Category	Number of Sequences	3D Structure?
F041345	Metagenome / Metatranscriptome	160	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0348332_106766192	F041345	AGTAG	MASPPVLRRRLFLAGLLACGLGPARAAARRYRIALADLDETPGVTIDGLGFTGADLRSSFEQAAREL