| Basic Information | |
|---|---|
| Taxon OID | 3300032497 Open in IMG/M |
| Scaffold ID | Ga0352988_1041940 Open in IMG/M |
| Source Dataset Name | Metatranscriptome of Cow rumen microbial communities from the University of Illinois at Urbana-Champaign, USA - Cow Y-2 rumen fluid (Eukaryote Metatranscriptome) |
| Source Dataset Category | Metatranscriptome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 587 |
| Total Scaffold Genes | 1 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Archaea → Euryarchaeota → Methanomada group → Methanobacteria → Methanobacteriales → Methanobacteriaceae → Methanobrevibacter → unclassified Methanobrevibacter → Methanobrevibacter sp. | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Host-Associated → Mammals → Digestive System → Foregut → Unclassified → Fungi-Associated Bovine Rumen → Fungi-Associated Bovine Rumen Microbial Communities From The University Of Illinois At Urbana-Champaign, Usa, For Metatranscriptome Analysis |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | USA: Illinois | |||||||
| Coordinates | Lat. (o) | 40.102108 | Long. (o) | -88.227299 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F086330 | Metagenome / Metatranscriptome | 111 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0352988_10419401 | F086330 | N/A | MVKSLRISTCSCIRAAHLDNSSQLFFTGSVNGFITIINLGIPGRERLISEMSRFNIGKMKIRVCVGNPKNNELITGDQEGRVTVWSLKTGRPVYIWEAHPKSAITKMWFQEEENLLWTGGKDLKINIWELPAKWVSNEAQSFEETQYKKITAKISQDIIAKKKYRKDKNGEYDSDDDDLNGWNFKEY |
| ⦗Top⦘ |