Scaffold Ga0314675_10334871

Overview

Basic Information

• Taxon OID: 3300032491
• Scaffold ID: Ga0314675_10334871
• Source Dataset Name: Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red2_26May_deep (Eukaryote Community Metatranscriptome)
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 757
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Chrysophyceae → Chromulinales → Chromulinaceae → Spumella → Spumella elongata (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Oceanic → Unclassified → Seawater → Seawater Microbial Communities From Espelandsvegen Fjord, Bergen, Norway

Source Dataset Sampling Location

• Location Name: Norway: Bergen
• Coordinates
  • Lat. (^o): 60.2696
  • Long. (^o): 5.2187

Associated Families

Family	Category	Number of Sequences	3D Structure?
F011203	Metatranscriptome	293	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0314675_103348712	F011203	N/A	AHTGPVGHPTHAMQRSPAYLAALVLAAVPNIRPAVAASLRVGAAQEPDVSCGKGFENLVKGSQDYYATASVKLWTHPSHRMDNATFEKEFQCWFASMCTTKCGGLPSQAEERKEKLTKACLSWTTDWLQVWKLFSTEELTWFKKNYPAEEQEAAADEATVHYKMAMHTAKEVSKKELLCMTLFTIDDECVKWPYIRLAQ