NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0352979_1048294

Scaffold Ga0352979_1048294


Overview

Basic Information
Taxon OID3300032487 Open in IMG/M
Scaffold IDGa0352979_1048294 Open in IMG/M
Source Dataset NameMetatranscriptome of Cow rumen microbial communities from the University of Illinois at Urbana-Champaign, USA - Cow X-2 rumen fluid (Eukaryote Metatranscriptome)
Source Dataset CategoryMetatranscriptome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)694
Total Scaffold Genes1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Mammals → Digestive System → Foregut → Unclassified → Fungi-Associated Bovine Rumen → Fungi-Associated Bovine Rumen Microbial Communities From The University Of Illinois At Urbana-Champaign, Usa, For Metatranscriptome Analysis

Source Dataset Sampling Location
Location NameUSA: Illinois
CoordinatesLat. (o)40.102108Long. (o)-88.227299Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F071855Metagenome / Metatranscriptome121N

Sequences

Protein IDFamilyRBSSequence
Ga0352979_10482941F071855N/AIDKIYDNFKEDFSKTYEIISELIKSYDESKKGNEDNTKQNNIIEVNKMKYPKTFHITTAFGGKKGFNQNSSAVKEFNLGKKVEFKILGLVVIPEKMVITPIKAEFHTENIFAHFTTFIGDLKPVQSNDILENLFSDGQEMENDYDDIIEGKSDECCKKVKVNIDGGEYDGYIYLNGKNSNLEGRMKEYYF

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.