Scaffold Ga0325395_100464

Overview

Basic Information

• Taxon OID: 3300032460
• Scaffold ID: Ga0325395_100464
• Source Dataset Name: Metatranscriptome of lab enriched sorghum-adapted microbial communities from California, United States - SM_Day14_2 (Metagenome Metatranscriptome)
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 6110
• Total Scaffold Genes: 7
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 3 (42.86%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Cellulomonadaceae → Actinotalea → Actinotalea fermentans (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Plant Biomass → Lab Enriched Sorghum-Adapted Microbial Communities From Joint Bioenergy Institute, Emeryville, California, United States

Source Dataset Sampling Location

• Location Name: USA: California
• Coordinates
  • Lat. (^o): 37.8406
  • Long. (^o): -122.2901

Associated Families

Family	Category	Number of Sequences	3D Structure?
F014042	Metagenome / Metatranscriptome	266	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0325395_1004647	F014042	N/A	AMRDVGYVVAGYAVTLAMLGAYRWRLAVRTRRARRYLSTATGRTGPAPTGPGRCR