Scaffold Ga0335398_10078116

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0335398_10078116

Scaffold Ga0335398_10078116

Overview

Basic Information
Taxon OID	3300032435 Open in IMG/M
Scaffold ID	Ga0335398_10078116 Open in IMG/M
Source Dataset Name	Freshwater microbial communities from Lake Bonney liftoff mats and glacier meltwater in Antarctica - BON-03 (spades assembly)
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	3310
Total Scaffold Genes	6 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	3 (50.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Ice → Glacial Lake → Freshwater → Freshwater Microbial Communities From Lake Liftoff Mats And Glacier Meltwater In Antarctica

Source Dataset Sampling Location
Location Name	Lake Bonney
Coordinates	Lat. (^o)	-77.714	Long. (^o)	162.445	Alt. (m)		Depth (m)	83
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F048109	Metagenome / Metatranscriptome	148	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0335398_100781166	F048109	N/A	SIHVDRIGVHSTFVYIYAVLRVLMIWANCLFSFKMSFLLRKVEDVTTISKSQSLTSVSIKDCTLRVPNKTTTLFLYEQ

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.