| Basic Information | |
|---|---|
| Taxon OID | 3300032421 Open in IMG/M |
| Scaffold ID | Ga0310812_10389062 Open in IMG/M |
| Source Dataset Name | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NN3 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 626 |
| Total Scaffold Genes | 1 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Cuspidothrix → Cuspidothrix issatschenkoi | (Source: IMG/M) |
| Source Dataset Ecosystem |
|---|
| Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil → Soil Microbial Communities From Experimental Microcosm In Duke University, North Carolina, United States |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | USA: North Carolina | |||||||
| Coordinates | Lat. (o) | 36.0 | Long. (o) | -78.0 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F021392 | Metagenome | 219 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0310812_103890621 | F021392 | N/A | MSAATATPSARPRAASLTGLRLILVATALVPVAALGVPSDIPMESRVLASILWVLCLAPAWHYLQLPERRRPPVPFLPLVGAVYLFYYPLHVVLGQSSVNYLFHLDPAFDYGRPVQYALVGWVALLIGYYGGAGLRLSSPFRHVRPTDLGTLRRWGKLLLWGGLLFDAARQVMPIPMVLRGLLYFTSMFSLLGISLLTILAVQK |
| ⦗Top⦘ |