Scaffold Ga0310812_10013765

Overview

Basic Information

• Taxon OID: 3300032421
• Scaffold ID: Ga0310812_10013765
• Source Dataset Name: Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NN3
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 2745
• Total Scaffold Genes: 5
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 4 (80.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Povalibacter → Povalibacter uvarum (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil → Soil Microbial Communities From Experimental Microcosm In Duke University, North Carolina, United States

Source Dataset Sampling Location

• Location Name: USA: North Carolina
• Coordinates
  • Lat. (^o): 36.0
  • Long. (^o): -78.0

Associated Families

Family	Category	Number of Sequences	3D Structure?
F019159	Metagenome / Metatranscriptome	231	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0310812_100137651	F019159	N/A	PAMRGVGVDTLRDAGERLVTVEIVPGLSTHGLLCPGSTYVGIGITADPRTQRIILVGDDTPASRAGLQHDDIVLNPEVWSEAHREGALLRVLIVRDGIKRIVPVRVGWICIG