NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0325403_1102576

Scaffold Ga0325403_1102576


Overview

Basic Information
Taxon OID3300032354 Open in IMG/M
Scaffold IDGa0325403_1102576 Open in IMG/M
Source Dataset NamePopulus deltoides microbial communities from Bellville, Georgia, United States - Xylem-PdKOR-R4
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1137
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus euphratica(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Plants → Wood → Unclassified → Unclassified → Xylem → Understanding The Reciprocal Impacts Of Modified Plant Cell Wall And Associated Microbiome

Source Dataset Sampling Location
Location NameUSA: Georgia
CoordinatesLat. (o)32.1348Long. (o)-81.9657Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F001798Metagenome632Y

Sequences

Protein IDFamilyRBSSequence
Ga0325403_11025761F001798N/AVDLVDNSTQALWLDEMTLIHSEFGKVFFMKVVGNHLIFPAIKFQSIWITRAQDMAKILSSAVGGHGG

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.