NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0310345_11476051

Scaffold Ga0310345_11476051


Overview

Basic Information
Taxon OID3300032278 Open in IMG/M
Scaffold IDGa0310345_11476051 Open in IMG/M
Source Dataset NameMarine microbial communities from station ALOHA, North Pacific Subtropical Gyre - HC15-DNA-20-500_MG
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)665
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Seawater → Comprehensive Metagenome And Single Cell Genome Sequencing From The Open Ocean Community Of North Pacfic Subtropical Gyre, Station Aloha

Source Dataset Sampling Location
Location NamePacific Ocean: North Pacific Subtropical Gyre
CoordinatesLat. (o)22.7719Long. (o)-158.0Alt. (m)Depth (m)500
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F048578Metagenome148Y

Sequences

Protein IDFamilyRBSSequence
Ga0310345_114760512F048578N/ATYICEMEIKRGYDQPSFAPLKEIFNEADLAKCLTPAHTEEVKVADKWATATVKSLAAKYGAEALRILENSRMESRGRLVFKRREAN

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.