Scaffold Ga0316202_10153006

Overview

Basic Information

• Taxon OID: 3300032277
• Scaffold ID: Ga0316202_10153006
• Source Dataset Name: Microbial mat bacterial communities from mineral coupon in-situ incubated in ocean water Damariscotta River, Maine, United States - 3-month pyrrhotite
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1071
• Total Scaffold Genes: 4
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 3 (75.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → Predicted Viral (Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Coastal → Sediment → Microbial Mat → Sediment Chemolithoautotrophic Microbial Communities From Various Locations

Source Dataset Sampling Location

• Location Name: USA: Maine
• Coordinates
  • Lat. (^o): 43.8603
  • Long. (^o): -69.5781

Associated Families

Family	Category	Number of Sequences	3D Structure?
F077490	Metagenome	117	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0316202_101530064	F077490	AGAAGG	MKNKIKVTGTINSWGHNSIDSTEVFFNKHIEDCSCGGSYSYSAMLQMEQIKAGDFVDDCATIECDNCYSMLDVDDYDIALEIPNNLTEQFAKEKIWCKSKDYVEMSQGVSTMDWDAQMGGKSFEELAEQELKAQGVL