Basic Information | |
---|---|
Taxon OID | 3300032276 Open in IMG/M |
Scaffold ID | Ga0316188_10398849 Open in IMG/M |
Source Dataset Name | Coastal sediment microbial communities from Maine, United States - Phippsburg worm burrow 1 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 723 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. FHR47 | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Coastal → Sediment → Worm Burrow → Sediment Chemolithoautotrophic Microbial Communities From Various Locations |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | USA: Maine | |||||||
Coordinates | Lat. (o) | 43.8293 | Long. (o) | -69.8133 | Alt. (m) | Depth (m) | 0 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F099198 | Metagenome | 103 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0316188_103988491 | F099198 | GGAG | MADAITGAIGAIIMVGYILLIAAKLAAPPLWIVSLIGLALMLWAFWGDDWKPLFVRKDNGNGNGK |
⦗Top⦘ |